PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00100.1.g00580.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 429aa    MW: 44996.3 Da    PI: 8.2688
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00100.1.g00580.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-39102161261
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                     ++k l+cprC+s++tkfCy+nny++sqPr+fCk+C+ryWt+GGa+rnvPvG+grrknk++
  Zjn_sc00100.1.g00580.1.am.mkhc 102 PDKVLPCPRCNSMDTKFCYFNNYNVSQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKNKNA 161
                                     78999****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3098159IPR003851Zinc finger, Dof-type
PfamPF027013.2E-32103160IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.994106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MGECRGGGGG AGDCLIKLFG KTIPVPEAGD AKDLQHSSGS SSSIDSDANK ENANQDTSDP  60
PPQPEVVDAE DPKSSSSPPE PRQPSGGADD EASNHKEKLK KPDKVLPCPR CNSMDTKFCY  120
FNNYNVSQPR HFCKNCQRYW TAGGAMRNVP VGAGRRKNKN AVAASHFLQK VRAAVPVGGD  180
PLKTNGTVLS FGAHGAAPAL DLAEQVVGHL KEKMLVPVGN AGNHQSVVDP CSDVSSTRDA  240
KNLSVNGVQH PANMNGGATM WPYGCAPPSQ AYYPSGIAIP IYPAAPGYWG CMVPGGWSPL  300
PWPLQPPTQG LSSPTSTAPS VSSGAGHSLT LGKHAREGDE GRSHGSGKVW APKTIRIGDA  360
DEVAKSSIWS LIGIKGDKQN TDTDGRKNGT VFEPKHEAKS AKQAMITSSP LLHANPVALT  420
RSLTFQEGS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5823992e-97KC582399.1 Sorghum bicolor dof2 protein (dof2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983151.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLK4AA810.0K4AA81_SETIT; Uncharacterized protein
STRINGSi035787m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-62cycling DOF factor 2